C20orf20 (MRGBP) (NM_018270) Human Tagged ORF Clone

CAT#: RC200114

MRGBP (Myc-DDK-tagged)-Human chromosome 20 open reading frame 20 (C20orf20)

Product Images

Circular map for RC200114

• 

  Western blot validation of overexpression lysate (Cat# LY413166) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200114 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: C20orf20
• Synonyms: C20orf20; Eaf7; MRG15BP; URCC4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200114 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGAGAGGCCGAGGTGGGCGGCGGGGGCGCCGCAGGCGACAAGGGCCCGGGGGAGGCGGCCACCAGCC
  CGGCGGAGGAGACAGTGGTGTGGAGCCCCGAGGTGGAGGTGTGCCTCTTCCACGCCATGCTGGGCCACAA
  GCCCGTCGGTGTGAACCGACACTTCCACATGATTTGTATTCGGGACAAGTTCAGCCAGAACATCGGGCGG
  CAGGTCCCATCCAAGGTCATCTGGGACCATCTGAGCACCATGTACGACATGCAGGCGCTGCATGAGTCTG
  AGATTCTTCCATTCCCGAATCCAGAGAGGAACTTCGTCCTTCCAGAAGAGATCATTCAGGAGGTCCGAGA
  AGGAAAAGTGATGATAGAAGAGGAGATGAAAGAGGAGATGAAGGAAGACGTGGACCCCCACAATGGGGCT
  GACGATGTTTTTTCATCTTCAGGGAGTTTGGGGAAAGCATCAGAAAAATCCAGCAAAGACAAAGAGAAGA
  ACTCCTCAGACTTGGGGTGCAAAGAAGGCGCAGACAAGCGGAAGCGCAGCCGGGTCACCGACAAAGTCCT
  GACCGCAAACAGCAACCCTTCCAGTCCCAGTGCTGCCAAGCGGCGCCGCACG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200114 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGR
  QVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGA
  DDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_018270
• ORF Size: 612 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_018270.6
• RefSeq Size: 1659 bp
• RefSeq ORF: 615 bp
• Locus ID: 55257
• UniProt ID: Q9NV56
• Cytogenetics: 20q13.33
• Protein Families: Transcription Factors
• MW: 22.4 kDa
• Gene Summary: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.[UniProtKB/Swiss-Prot Function]