OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-ABCB4 antibodies

Anti-ABCB4 POLYCLONAL Antibody

div

Specifications Citations (1) Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA346193 Rabbit Polyclonal Anti-ABCB4 Antibody 50ug $325 2 Weeks
Add to Shopping Cart
spacer
WB(2)

OriGene Data

ImmunogenThe immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
Clone Name IsotypeIgG
Species ReactivityRabbit, Rat, Human, Mouse, Pig, Bovine, Sheep, Dog, Horse, Guinea pig ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 141kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 86%; Dog: 77%; Horse: 77%; Sheep: 77%; Guinea pig: 77%

Reference Data

Target NameHomo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
Alternative NameABC21; GBD1; ICP3; MDR2; MDR2/3; MDR3; PFIC-3; PGY3
Database LinkNP_000434
Entrez Gene 5244 Human
Entrez Gene 18670 Mouse
Entrez Gene 24891 Rat
Entrez Gene 0 Monkey
Entrez Gene 482284 Dog
FunctionABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. ABCB4 is a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.
Related PathwayTransmembraneDruggable Genome ABC transporters

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
WB Suggested Anti-ABCB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate
spacer

WB Image
Host: Rabbit; Target Name: ABCB4; Sample Tissue: 293T Whole Cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/Lane; Gel Concentration: 0.12
spacer

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge