Products

View as table Download

COX7A2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50).

Rabbit Polyclonal Anti-COX7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY

Rabbit Polyclonal Anti-COX7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the C-terminal region of Human COX7A2. Synthetic peptide located within the following region: LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE