Oligodendrocyte Markers

View as table Download

Mouse Monoclonal MBP Antibody (2H9)

Applications ELISA, FC, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336919 is a replacement of AM06698SU-N.

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Bovine, Monkey)
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Carrier-free (glycerol/BSA-free) MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRG2 mouse monoclonal antibody,clone OTI2F11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRG2 mouse monoclonal antibody,clone OTI10D10

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PRG2 mouse monoclonal antibody,clone OTI1C12

Applications WB
Reactivities Human
Conjugation Unconjugated