Antibodies

View as table Download

Anti-VTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-154 amino acids of human vitronectin

Rabbit Polyclonal Anti-VTN Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human VTN

Rabbit polyclonal VTN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This VTN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 65-93 amino acids from the N-terminal region of human VTN.

Rabbit Polyclonal Anti-VTN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE

Rabbit Polyclonal Anti-Vtn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI