Antibodies

View as table Download

Anti-SLC5A5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human solute carrier family 5 (sodium iodide symporter), member 5

Rabbit Polyclonal Anti-SLC5A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A5 Antibody: synthetic peptide directed towards the middle region of human SLC5A5. Synthetic peptide located within the following region: PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRP

Rabbit Polyclonal Anti-SLC5A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A5 Antibody: synthetic peptide directed towards the N terminal of human SLC5A5. Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR