Antibodies

View as table Download

Rabbit Polyclonal Anti-OSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OSR1 antibody is: synthetic peptide directed towards the N-terminal region of Human OSR1. Synthetic peptide located within the following region: PIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP

OSR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human OSR1.

OSR1 Antibody - middlel region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse OSR1

OSR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human OSR1.

OSR1 pThr310 rabbit polyclonal antibody, Aff - Purified

Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T310 of human OSR1.