Antibodies

View as table Download

KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KARS mouse monoclonal antibody,clone OTI1E7, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KARS mouse monoclonal antibody,clone OTI1E7, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS

Lysyl tRNA synthetase (KARS) (N-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 77-105 amino acids from the N-terminal region of human KARS

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV