Antibodies

View as table Download

HOXC4 mouse monoclonal antibody,clone OTI6B11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXC4 mouse monoclonal antibody,clone OTI3F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HOXC4 mouse monoclonal antibody,clone OTI1A6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HOXC4 mouse monoclonal antibody,clone OTI6B11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HOXC4 mouse monoclonal antibody,clone OTI3F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXC4 mouse monoclonal antibody,clone OTI1A6, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HOXC4 mouse monoclonal antibody,clone OTI1A6, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HOXC4 mouse monoclonal antibody,clone OTI6B11, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HOXC4 mouse monoclonal antibody,clone OTI6B11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HOXC4 mouse monoclonal antibody,clone OTI3F3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HOXC4 mouse monoclonal antibody,clone OTI3F3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HOXC4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC4

HOXC4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC4

HOXC4 mouse monoclonal antibody,clone OTI2A5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HOXC4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4. Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ