Antibodies

View as table Download

Rabbit Polyclonal Anti-APMAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APMAP

APMAP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APMAP

Rabbit Polyclonal Anti-APMAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APMAP antibody: synthetic peptide directed towards the N terminal of human APMAP. Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Rabbit Polyclonal Anti-APMAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APMAP antibody: synthetic peptide directed towards the C terminal of human APMAP. Synthetic peptide located within the following region: QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL