Antibodies

View as table Download

Rabbit Polyclonal Anti-ADAM23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADAM23 antibody is: synthetic peptide directed towards the N-terminal region of Human ADAM23. Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY

ADAM23 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 802-831 amino acids from the C-terminal region of human ADAM23

Rabbit Polyclonal Anti-Adam23 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Adam23 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD

ADAM23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAM23