Antibodies

Jump to Filters
View as table Download
SEPTIN6 Rabbit Polyclonal Antibody
TA312371

USD 380.00

In Stock

Rabbit polyclonal anti-SEPT6 antibody

Applications IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SEPT6.
SEPTIN6 Goat Polyclonal Antibody
TA305718

USD 520.00

5 Days

Goat Anti-SEPT6 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Cow, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEVNAFKQRKTA, from the internal region of the protein sequence according to NP_665798.1; NP_055944.2; NP_665801.1.
SEPTIN6 Rabbit Polyclonal Antibody
TA339322

USD 485.00

5 Days

Rabbit Polyclonal Anti-SEPT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT6(septin 6) antibody: synthetic peptide directed towards the middle region of human SEPT6(septin 6). Synthetic peptide located within the following region: CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
SEPTIN6 Rabbit Polyclonal Antibody
TA339323

USD 539.00

5 Days

Rabbit Polyclonal Anti-SEPT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT6(septin 6) antibody: synthetic peptide directed towards the N terminal of human SEPT6(septin 6). Synthetic peptide located within the following region: TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV