Antibodies

Jump to Filters
View as table Download
FGF1 Mouse Monoclonal Antibody [Clone ID: OTI4D2]
TA500064

USD 447.00

In Stock

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF1 Mouse Monoclonal Antibody [Clone ID: OTI4D2]
CF500064

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) aFGF mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF1 Rabbit Polyclonal Antibody
TA323919

USD 380.00

4 Weeks

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1
FGF1 Rabbit Polyclonal Antibody
TA323920

USD 380.00

In Stock

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1
FGF1 Mouse Monoclonal Antibody [Clone ID: OTI4D2]
TA500064S

USD 200.00

2 Days

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF1 Rabbit Polyclonal Antibody
TA336219

USD 539.00

5 Days

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
FGF1 (C-term) Rabbit Polyclonal Antibody
AP23402PU-N

USD 560.00

2 Weeks

FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1