Anti-TNNI3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TNNI3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS |
Rabbit Polyclonal Anti-MYL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYL3 |
USD 380.00
In Stock
Rabbit Polyclonal Anti-UQCRC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UQCRC1 |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UQCRC2 |
Anti-TPM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-TPM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ATP1A1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Rabbit Polyclonal Anti-CACNA1C Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNA1C |
Rabbit Polyclonal Anti-CACNA1D Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNA1D |
Rabbit Polyclonal Anti-CACNB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNB2 |
Rabbit polyclonal CACNG6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Anti-CACNB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF |
Rabbit Polyclonal Nhe-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1. |
Rabbit Polyclonal Nhe-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1. |