Antibodies

Jump to Filters
View as table Download
COX15 Rabbit Polyclonal Antibody
TA368136

USD 380.00

4 Weeks

COX15 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human COX15
COX15 Rabbit Polyclonal Antibody
TA339409

USD 485.00

5 Days

Rabbit Polyclonal Anti-COX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
COX15 Rabbit Polyclonal Antibody
TA375013

USD 365.00

3 Weeks

COX15 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human COX15 (NP_510870.1).
Modifications Unmodified
COX15 Rabbit Polyclonal Antibody
TA372368

USD 380.00

4 Weeks

COX15 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human COX15