Rabbit Polyclonal APC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7. |
Rabbit Polyclonal APC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7. |
Rabbit Polyclonal Anti-ANAPC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |