Mouse Monoclonal NAK Antibody (108A429)
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine |
Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
Mouse Monoclonal NAK Antibody (108A429)
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine |
Conjugation | Unconjugated |
TBK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding S172 of human TBK. |
TBK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBK1 |
Rabbit Polyclonal NAK Antibody
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NAK antibody was raised against a synthetic peptide corresponding to 17 amino acids form near the carboxy terminus of human NAK/TBK1. |
Goat Polyclonal TBK1 (aa514-527) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TIETSLQDIDSRLS, from the C or N Terminus of the protein sequence according to NP_037386.1 |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
Phospho-TBK1/NAK-S172 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S172 of human TBK1/NAK (NP_037386.1). |
Modifications | Phospho S172 |
TBK1 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human, Hamster, Rat |
Conjugation | Unconjugated |
Phospho-TBK1/NAK-S172 Rabbit mAb
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho synthetic peptide corresponding to residues surrounding S172 of Human TBK1/NAK. |