Rabbit Polyclonal Bfl-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1. |
Rabbit Polyclonal Bfl-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1. |
Anti-BCL2A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1 |
Rabbit Polyclonal Bfl-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
BCL2A1 polyclonal antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to Human BCL2A1. |