Antibodies

View as table Download

Rabbit Polyclonal Anti-STAG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STAG2

Goat Polyclonal Antibody against STAG2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-REPKRLRPEDS, from the internal region of the protein sequence according to NP_001036214.1; NP_001036215.1 ; NP_001036216.1 ; NP_006594.3.

Rabbit Polyclonal Anti-STAG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAG2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAG2. Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS