C1QA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli. |
C1QA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli. |
Rabbit Polyclonal Anti-IL1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL1A |
Rabbit polyclonal C1QC Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit polyclonal anti-LAMC1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit polyclonal C1QB Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB. |
Rabbit Polyclonal Anti-C1QA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG |
Rabbit polyclonal C1QC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1QC. |
Rabbit polyclonal anti-C6 (complement component 6) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C6. |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-C1QB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
Rabbit Polyclonal Anti-LAMC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ |
IL1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL1A |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Goat Anti-IL-1 beta Antibody
Applications | PEP-ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLESVDPKNYPKK, from the internal region of the protein sequence according to NP_000567.1. |