USD 447.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
2 Days
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 200.00
In Stock
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
USD 200.00
2 Days
CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |