Rabbit Polyclonal Anti-TPH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TPH2 |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TPH2 |
Rabbit polyclonal TPH2 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2. |
USD 190.00
USD 380.00
In Stock
Rabbit polyclonal TPH2 (Ab-19) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19 (G-FI-SP-L-D). |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS |
Rabbit Polyclonal Anti-TPH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the middle region of human TPH2. Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA |
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
Modifications | Phospho-specific |