Germany
Japan
United Kingdom
China
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Antibodies
View as table Download
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Goat Polyclonal Antibody against FOXA2
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1. |
Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823) |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal Anti-FOXA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against TCF2 / VHNF1
| Applications | ICC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1. |
Active filters
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Maturity onset diabetes of the young