Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Rabbit Polyclonal Antibody against Carbonic Anhydrase IX
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CA IX. |
Rabbit polyclonal antibody to Adenosine Deaminase (adenosine deaminase, RNA-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 472 and 757 of ADAR1 (Uniprot ID#P55265) |
ABCC4 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Germany
Japan
United Kingdom
China
