Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit Polyclonal Anti-CYP2C18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |