Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Rabbit anti-PRDX6 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX6 |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
PRDX6 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | internal region (TAEKRVATPVD) |
Goat Anti-peroxiredoxin 6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |