Antibodies

View as table Download

Rabbit polyclonal TK (Ab-13) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S).

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492)

Rabbit polyclonal ITPA Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Xenopus)
Conjugation Unconjugated
Immunogen This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA.

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492)

Rabbit polyclonal CYP3A5 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5.

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD