Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit Polyclonal anti-BRAF Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BRAF |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Anti-RAC2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
MSH6 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit Polyclonal APC Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |