C4B mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
C4B mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C4B mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
C4B mouse monoclonal antibody,clone OTI1B2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
C4B mouse monoclonal antibody,clone OTI1B2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-C4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
Complement C4B Chicken Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Complement C4B antibody was raised against purified human complement C4b. |
C4B mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |