GOT2 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | internal region (QGYRYYDPKTCGFD) |
GOT2 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | internal region (QGYRYYDPKTCGFD) |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA |
Rabbit Polyclonal Anti-IL4I1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
TAT mouse monoclonal antibody,clone OTI3G6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |