Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)

Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908)

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG