Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 500.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
Applications | ELISA, IHC, R |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal ATM Antibody
Applications | ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
Rabbit Polyclonal AKT2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Caspase 7 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Mouse monoclonal Akt phospho S473 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
IRAK4 (2-13) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Bat, Equine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the N-terminus of human IRAK4 (NP_057207.2; NP_001107654.1) |
Mouse monoclonal Akt phospho T308 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal anti-AKT1 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |