Rabbit Polyclonal FXR Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminus of the human FXR protein. |
Rabbit Polyclonal FXR Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminus of the human FXR protein. |
Rabbit Polyclonal Anti-NR1H4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT |
Rabbit Polyclonal Anti-NR1H4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
NR1H4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human NR1H4 |