JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

TEST

5 Days*

$525.00

Rabbit Polyclonal Anti-APTX Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX. Synthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ