Vegfa (NM_001110336) Rat Recombinant Protein

CAT#: TP723470

Purified recombinant protein of Rat vascular endothelial growth factor A (Vegfa), transcript variant 5.


 Product Datasheet for 'TP723470'

  View other "Vegfa" proteins (26)

Use code "PROTEIN10" to save 10%

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat vascular endothelial growth factor A (Vegfa), transcript variant 5.
Species Rat
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Tag Tag Free
Predicted MW 38.5 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by the dose-dependent stimulation of the proliferation of Human umbilical vein endothelial cells (HUVEC). The expected ED50 is 4.0-8.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_001103806
Locus ID 83785
Refseq Size 2544
Refseq ORF 255
Synonyms Vegf; VEGF-A; VEGF111; VEGF164; VPF

Documents

Other Versions

Other products for "Vegfa"
Frequently bought together (1)
VEGFA mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies