Thpo (NM_009379) Mouse Recombinant Protein

CAT#: TP723457

Reviews ()
Write a review

Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2.



  View other "Thpo" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2.
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Tag Tag Free
Predicted MW 18.7 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be > 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_033405
Locus ID 21832
Refseq Size 2262
Cytogenetics 16 12.51 cM
Refseq ORF 1071
Synonyms Mgdf; Ml; Mpllg; Tpo
Summary This gene encodes a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. The encoded protein is a ligand for the product of the myeloproliferative leukemia virus oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Documents

Other Versions

Other products for "Thpo"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101