Thpo (NM_031133) Rat Recombinant Protein

CAT#: TP723456

Reviews ()
Write a review

Purified recombinant protein of Rat thrombopoietin (Thpo).


Product Datasheet for 'TP723456'


  View other "Thpo" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat thrombopoietin (Thpo).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKF
Tag Tag Free
Predicted MW 18.7 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to stimulate the proliferation of human MO7e cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_112395
Locus ID 81811
Refseq Size 1406
Cytogenetics 11q23
Refseq ORF 978
Summary lineage-specific cytokine; important for proliferation and development of megakaryocytes and platelets; may be the major regulator of circulating platelets [RGD, Feb 2006]

Documents

Other Versions

Other products for "Thpo"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101