Cxcl12 (NM_001033882) Rat Recombinant Protein

CAT#: TP723407

Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.

Specifications

Product Data

• Description: Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.
• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM
• Tag: Tag Free
• Predicted MW: 8.4 kDa
• Concentration: lot specific
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human monocytes using a concentration range of 100.0-200.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001029054
• Locus ID: 24772
• Refseq Size: 2850
• Cytogenetics: 4q42
• Refseq ORF: 279
• Synonyms: Sdf1
• Summary: a chemoattractant molecule; involved in cell migration [RGD, Feb 2006]