Cxcl12 (NM_022177) Rat Recombinant Protein

CAT#: TP723404

Reviews ()
Write a review

Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.



  View other "Cxcl12" proteins (6)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK
Tag Tag Free
Predicted MW 7.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 50.0-100.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_071513
Locus ID 24772
Refseq Size 2850
Cytogenetics 4q42
Refseq ORF 279
Synonyms Sdf1
Summary a chemoattractant molecule; involved in cell migration [RGD, Feb 2006]

Documents

Other Versions

Other products for "Cxcl12"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101