SCF (KITLG) (NM_000899) Human Recombinant Protein

CAT#: TP723397

Reviews ()
Write a review

Purified recombinant protein of Human KIT ligand (KITLG), transcript variant b.


 Product Datasheet for 'TP723397'

  View other "KITLG" proteins (14)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human KIT ligand (KITLG), transcript variant b.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Tag Tag Free
Predicted MW 18.4 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_000890
Locus ID 4254
Refseq Size 5435
Cytogenetics 12q21.32
Refseq ORF 819
Synonyms FPH2; FPHH; Kitl; KL-1; MGF; SCF; SF; SHEP7
Summary This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Melanogenesis, Pathways in cancer

Documents

Other Versions

Other products for "KITLG"
Frequently bought together (1)
KITLG mouse monoclonal antibody, clone OTI5F6 (formerly 5F6)
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101