Cd40lg (NM_011616) Mouse Recombinant Protein

CAT#: TP723396

Purified recombinant protein of Mouse CD40 ligand (Cd40lg).


 Product Datasheet for 'TP723396'

USD 230.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse CD40 ligand (Cd40lg).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Tag Tag Free
Predicted MW 16.4 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce TNF-alpha; and MIP-1alpha; production by murine splenocytes. The expected ED50 for this effect is > 0.1 ug/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_035746
Locus ID 21947
Refseq Size 1250
Refseq ORF 780
Synonyms CD154; CD40-L; Cd40l; gp39; HIGM1; IGM; IMD3; Ly-62; Ly62; T-BAM; Tnfsf5; Tnlg8b; TRAP

Documents

Other products for "Cd40lg"
Frequently bought together (1)
Rabbit Polyclonal Anti-CD40LG Antibody
    • 100 ul

USD 335.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones