Pf4 (NM_019932) Mouse Recombinant Protein

CAT#: TP723363

Purified recombinant protein of Mouse platelet factor 4 (Pf4).


 Product Datasheet for 'TP723363'

  View other "Pf4" proteins (1)

USD 230.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse platelet factor 4 (Pf4).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Tag Tag Free
Predicted MW 8.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_064316
Locus ID 56744
Refseq Size 525
Refseq ORF 315
Synonyms Cxcl4; Scyb4

Documents

Other Versions

Frequently bought together (1)
Anti-Human PF-4 Rabbit Polyclonal Antibody
    • 100 ug

USD 275.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones