M-CSF (CSF1) (NM_172212) Human Recombinant Protein
Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4.
Specifications
Product Data | |
Description | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4. |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence | MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS |
Tag | Tag Free |
Predicted MW | 36.8 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NSF-60 cells < 1 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_757351 |
Locus ID | 1435 |
Refseq Size | 2772 |
Cytogenetics | 1p13.3 |
Refseq ORF | 1662 |
Synonyms | CSF-1; MCSF |
Summary | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 170.00 |
|
LC406741 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LC406742 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LC424534 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LC430359 | CSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY403534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
USD 550.00 |
|
LY406741 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
USD 360.00 |
|
LY406742 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 360.00 |
|
LY424534 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 360.00 |
|
LY430359 | Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 360.00 |
|
PH305855 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) |
USD 2,260.00 |
|
PH313103 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) |
USD 2,260.00 |
|
PH317104 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) |
USD 2,260.00 |
|
PH317172 | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) |
USD 2,260.00 |
|
TP305855 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 788.00 |
|
TP313103 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 |
USD 748.00 |
|
TP317104 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 748.00 |
|
TP317172 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 |
USD 748.00 |
|
TP720352 | Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 |
USD 300.00 |
|
TP723739 | Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 |
USD 205.00 |
USD 379.00