Ccl7 (NM_013654) Mouse Recombinant Protein

CAT#: TP723285

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7).


 Product Datasheet for 'TP723285'

  View other "Ccl7" proteins (1)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Tag Tag Free
Predicted MW 8.5 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_038682
Locus ID 20306
Refseq Size 911
Refseq ORF 291
Synonyms fic; marc; MCP-3; mcp3; Scya7

Documents

Other Versions

Other products for "Ccl7"
Frequently bought together (1)
Rabbit Polyclonal Anti-CCL7 Antibody
    • 100 ul

USD 335.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones