LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein

CAT#: TP723271

Reviews ()
Write a review

Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1.


Product Datasheet for 'TP723271'


  View other "TNFSF14" proteins (4)

USD 240.00


Availability*
5 Days

Size
    • 15 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1.
Species Human
Expression Host Hi-5 insect
Expression cDNA Clone or AA Sequence RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Tag Tag Free
Predicted MW 19.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-gamma.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_003798
Locus ID 8740
Refseq Size 1491
Cytogenetics 19p13.3
Refseq ORF 720
Synonyms CD258; HVEML; LIGHT; LTg
Summary The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction

Documents

Other Versions

Other products for "TNFSF14"
Frequently bought together (1)
Rabbit Polyclonal Anti-TNFSF14 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101