Lep (NM_013076) Rat Recombinant Protein

CAT#: TP723269

Purified recombinant protein of Rat leptin (Lep).


 Product Datasheet for 'TP723269'

  View other "Lep" proteins (3)

Use code "PROTEIN10" to save 10%

USD 135.00

USD 199.00


Availability*
5 Days

Size
    • 200 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat leptin (Lep).
Species Rat
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Tag Tag Free
Predicted MW 16.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by an in vivo assay using the ob/ob mouse obesity model and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5µg leptin/gm of body weight for 7 days. Significant effects on body weight, food consumption, and plasma glucose levels were observed to saline-treated controls.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_037208
Locus ID 25608
Refseq Size 3290
Refseq ORF 501
Synonyms OB; obese

Documents

Other Versions

Frequently bought together (1)
Anti-Human Leptin Rabbit Polyclonal Antibody
    • 100 ug

USD 275.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies