Lep (NM_013076) Rat Recombinant Protein

CAT#: TP723269

Reviews ()
Write a review

Purified recombinant protein of Rat leptin (Lep).



  View other "Lep" proteins (2)

USD 140.00


Availability*
5 Days

Size
    • 200 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat leptin (Lep).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Tag Tag Free
Predicted MW 16.2 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by an in vivo assay using the ob/ob mouse obesity model and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5µg leptin/gm of body weight for 7 days. Significant effects on body weight, food consumption, and plasma glucose levels were observed to saline-treated controls.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_037208
Locus ID 25608
Refseq Size 3290
Cytogenetics 4q22
Refseq ORF 501
Synonyms OB; obese
Summary involved in regulation of body weight, and may have a role in angiogenesis [RGD, Feb 2006]

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101