Cxcl1 (NM_030845) Rat Recombinant Protein

CAT#: TP723258

Reviews ()
Write a review

Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (Cxcl1).



  View other "Cxcl1" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (Cxcl1).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Tag Tag Free
Predicted MW 7.8 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_110472
Locus ID 81503
Refseq Size 929
Cytogenetics 14p22
Refseq ORF 288
Synonyms CINC-1; Gro1
Summary acts as a neutrophil chemoattractant; may play a role in acute phase inflammatory response [RGD, Feb 2006]

Documents

Other Versions

Other products for "Cxcl1"
Frequently bought together (1)
Anti-Rat GRO/KC Rabbit Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101