Ccl2 (NM_011333) Mouse Recombinant Protein

CAT#: TP723257

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2).


 Product Datasheet for 'TP723257'

  View other "Ccl2" proteins (4)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Tag Tag Free
Predicted MW 13.8 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 1.0-20.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_035463
Locus ID 20296
Refseq Size 806
Refseq ORF 447
Synonyms AI323594; HC11; JE; MCAF; MCP-1; MCP1; Scya2; Sigje; SMC-CF

Documents

Other Versions

Other products for "Ccl2"
Frequently bought together (1)
CCL2 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones