Il9 (NM_001105747) Rat Recombinant Protein

CAT#: TP723250

Reviews ()
Write a review

Purified recombinant protein of Rat interleukin 9 (Il9).



  View other "Il9" proteins (1)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat interleukin 9 (Il9).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MQRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
Tag Tag Free
Predicted MW 14.3 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001099217
Locus ID 116558
Refseq Size 563
Cytogenetics 17p14
Refseq ORF 432
Summary cytokine involved in mast cell and megakaryioblastic leukemic cell proliferation and hemopoietic cell growth; human homolog may be involved in Hodgkins disease, malignant lymphoma, and asthma [RGD, Feb 2006]

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101