Il1b (NM_031512) Rat Recombinant Protein

CAT#: TP723212

Reviews ()
Write a review

Purified recombinant protein of Rat interleukin 1 beta (Il1b).



  View other "Il1b" proteins (4)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat interleukin 1 beta (Il1b).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Tag Tag Free
Predicted MW 17.4 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 was determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_113700
Locus ID 24494
Refseq Size 1339
Cytogenetics 3q36
Refseq ORF 804
Synonyms IL-1F2
Summary an inflammatory cytokine [RGD, Feb 2006]

Documents

Other Versions

Other products for "Il1b"
Frequently bought together (1)
Biotinylated Anti-Rat IL-1β Rabbit Polyclonal Antibody
    • 50 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101